DPCstruct | MC34439
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 300 ± 28 aa |
| Standard deviation of domain lengths | 28.46 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 79.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 23.09 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0111 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0K0ECD4 | 252-496 | TIFIICSCLFWQFSQFVFFTQVFALFILYLLSYIPKNVISSLIYSHLIGFMLSFVLLFGNDMMLTSLYLTSLLSFIIIFYFLSYFES… |
| L5MEY8 | 238-535 | LLTIFTSTFVFSLTWQFNQFTMLVQALGLFALDSLGMLPAAKATWLYSIQVTALLLVCALQFFNSMILGSLLISFNLSVLIARKLQK… |
| A0A4E0RZT1 | 105-428 | None |
| A0A7R8CFV4 | 418-687 | None |
| A0A6J1WJB4 | 1-310 | None |
| A0A4Z2DJE9 | 352-674 | None |
| A0A0S7L2J2 | 1-307 | None |
| A0A564YRM9 | 348-657 | None |
| A0A0D9QHM7 | 25-374 | None |
| A0A5E4AZV3 | 56-349 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.