DPCstruct | MC34436
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 100 ± 16 aa |
| Standard deviation of domain lengths | 15.93 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 80.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 38.79 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A158QYK2 | 67-140 | EEMMRTGFDFELDGLLYYHSGVVYEAGQSPLVGWLKPWMLPEILNVTVPQKFLNENLLQQSSQQFIDAFNVQHN |
| A0A183VWL8 | 2-81 | QNAFSSMPSYEVDGVLFYHDDVNYEPGATPLVNWLKPYMLPEWFPNIKFHSDFMKNMPSDYTDYLNEIRQYEANSSKSLK |
| A0A0D8XT93 | 264-379 | None |
| A0A158N7X3 | 227-336 | None |
| A0A1I8FQI7 | 52-190 | None |
| A0A670Z3T0 | 60-168 | None |
| A0A834BNR8 | 1-82 | None |
| A0A3P7G455 | 1-91 | None |
| T1JE87 | 478-598 | None |
| A0A183LWZ8 | 103-191 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.