DPCstruct | MC34435
Metacluster Properties and Pfam Annotations
| Number of structural domains | 48 |
|---|---|
| Mean domain length (aa) | 198 ± 42 aa |
| Standard deviation of domain lengths | 42.09 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 78.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 25.24 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10537 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0P0WAJ7 | 1-105 | MPLLKRRPFFLLDPPKDLNPEDKVFQVRYTKEIFRDYQEYLNRVNLYRERVWTCKVSGKSNLTYEEALVSEHHAAEKAQQLPRELIA… |
| A0A183VVG2 | 1-177 | MPNLNGETFVKRQPPSDLSMDEELFFLPTTLEVFRDYDDYFERTILVNSMIWTCSVCNRGPSTYKEAVACERADYRQLSAFDNALAS… |
| A0A821AJ79 | 1-243 | None |
| A0A183QGH2 | 1-243 | None |
| A0A7D9L8J9 | 2-192 | None |
| A0A0N5CVI0 | 23-223 | None |
| A0A3B4XGX0 | 1-245 | None |
| A0A7I8KFB2 | 1-203 | None |
| A0A0D2N1S4 | 1-126 | None |
| A0A183P3Y1 | 10-249 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.