DPCstruct | MC34433
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 86 ± 4 aa |
| Standard deviation of domain lengths | 4.20 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 89.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 40.67 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0286 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183VKW4 | 1-88 | VGLIEIVTEPDFNSSDQTAAFITDLSRLLKHLKCCNAIGAFGELRVDVNVSIGEDAANQNPRVEIKNLNSIHDVINSIGGFVSDFLLQ |
| A0A2H3JQ65 | 65-148 | LMVIVSEPDMRSPEEAGTYVRALQALLRAIGASDGNMEQGSLRCDVNVSVNRKGAGLGTRCEIKNLNSVKFMMVAITAEAYRHI |
| A0A3P7LXR6 | 55-133 | None |
| A0A453BPT8 | 1-81 | None |
| A0A2V4PBU0 | 64-148 | None |
| A0A287I6T8 | 86-173 | None |
| A0A2C9JR38 | 568-656 | None |
| A0A482WU22 | 135-220 | None |
| A0A044V152 | 117-203 | None |
| A0A059X2H7 | 80-172 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.