DPCstruct | MC3443
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 580 ± 83 aa |
| Standard deviation of domain lengths | 83.20 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 79.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 25.38 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0127 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N6N554 | 59-681 | SVLNIELRGKISDQVKSRFSSGLSLPQLCENLIKAAYDPHISGVYLHIETLNCGWGKIEEIRRHILDFRKSGKFTIGYAPEWREKEY… |
| A0A285ZTX9 | 246-755 | TSRNPYASRSAQIVRVPLNMDVTEVEKKMLFLGPSSIGLMKVRNLFEHLLRDPAAGLVVLDFSGYSGNLAISEEINRYVKKLKARGG… |
| A0A2G2WR63 | 147-650 | None |
| A0A7Z9Y3N9 | 2-537 | None |
| A0A812SA46 | 6-528 | None |
| A0A2N1JE98 | 344-1008 | None |
| A0A832IW20 | 2-478 | None |
| A0A0A2W3Q6 | 47-577 | None |
| A0A7W5YRH0 | 1-636 | None |
| A0A2V0NRU5 | 40-678 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.