DPCstruct | MC34429
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 69 ± 10 aa |
| Standard deviation of domain lengths | 10.11 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 88.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 61.47 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C9EA48 | 197-262 | LNCLMYKLCYYRFGELHTEYGKPPGYDRARGVEIGNKDVKLEHLEEAFTTSNWIVRIYRVKPPNNR |
| A0A444E9C6 | 172-234 | MYKLSYYRFGEVTTEYGKPTGYDRARGVEIGNKDIKLEYLEEAFTTSNWIIRIYKVKPPKNRW |
| A0A6I8P762 | 712-776 | None |
| A0A2T7PF01 | 952-1016 | None |
| A0A183NJQ6 | 111-178 | None |
| A0A484CR75 | 974-1038 | None |
| Q6F2Z1 | 698-787 | None |
| A0A7I8VU91 | 1141-1205 | None |
| A0A6A0AB94 | 6-68 | None |
| A0A699MDY9 | 1-90 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.