DPCstruct | MC34428
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 99 ± 5 aa |
| Standard deviation of domain lengths | 5.25 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 87.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 57.18 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5K4F3R5 | 30-123 | YDYLVNVIRQTDKDTLIFYESVTYGIYFPFVNGIPGTGMQRVPGLLQDEMARKKSVLSYHYYCWLLQSTPATEHMPSWKQYLCDQLL… |
| A0A183VIF5 | 29-125 | GYAGRYNLQPVYDYLVERIRKHDTETLIFYEPITYGIFTPFTTSWLGTGFERVPGANKDKSAPNKSVLSYHYYCWILQTENSNSTMP… |
| A0A448X7W4 | 2-98 | None |
| A0A814FLR7 | 420-515 | None |
| A0A819HML8 | 144-246 | None |
| A0A820KN11 | 89-181 | None |
| A0A6A5DCP8 | 254-352 | None |
| A0A5K4F456 | 253-352 | None |
| A0A5K4EZK4 | 4-99 | None |
| A0A4Z2DKA8 | 461-556 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.