DPCstruct | MC34427
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 66 ± 4 aa |
| Standard deviation of domain lengths | 4.06 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 80.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 51.67 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S1AXA5 | 143-200 | IDRLKDLEKVGRLNGIFDDRGKYLYITQQEMSDVAAWLTDKGRLNRKELLAACNRLIR |
| A0A183VI30 | 3-68 | CVEKIKSLMSSGRLSGVLDDRGKFVHITDEEYEAVAEFIEKRGRITLAELVENGHKLIHTGPHSLR |
| T1FTE2 | 508-574 | None |
| A0A0V1DES6 | 493-557 | None |
| A0A1L8HSI4 | 694-756 | None |
| A0A5S6QQS9 | 752-813 | None |
| A0A0V0WV75 | 412-478 | None |
| A0A0V1AAY3 | 319-384 | None |
| A0A835WWV9 | 162-227 | None |
| A0A820RRJ6 | 1-79 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.