DPCstruct | MC34425
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 132 ± 13 aa |
| Standard deviation of domain lengths | 12.83 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 72.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 31.15 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q2JBD9 | 8-142 | RVEQDELRARMRAVGMSHDEIAIEFARRYHYRPRAAHRHARGWTQTQAANHINAHAARAGLDPDGAAPMTEQEIHDMVTAVGDIVAV… |
| A0A5C8J8W5 | 1-122 | MRKRLSKCDRKLGQYRSALDAGGDPIEIAGWINETKIERARLVGELKAAPAVRRISVAEIRSVIEEVGDLVRLVGEADPDDKAALYT… |
| A0A515YNG9 | 39-163 | None |
| A0A1I6FGZ7 | 97-249 | None |
| A0A4P7GYJ6 | 15-131 | None |
| A0A1I1QZB5 | 2-136 | None |
| A0A6V8LAN4 | 81-229 | None |
| A0A7W2YUG0 | 2-119 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.