DPCstruct | MC34422
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 382 ± 48 aa |
| Standard deviation of domain lengths | 47.75 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 83.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.47 |
| Mean intra-cluster sequence similarity (%) | 14.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0093 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M0WS10 | 15-405 | MTAVNDFAYALQDESQPLVAQARSYAQSFTNVFGNNVAPSYIDLGNFIQVLQRQTGNTTVKQRGDAVLTALSQAIVAEKHGPDKPGA… |
| A0A7K3YW79 | 43-422 | KTFSLVRLDKTPSVVSSLDTLGHSLREGLDDADSLAALGDIYTNIQGYGRSDDGSTVTSVDLYAFADLIRANTEEGSSLHTSAGDLQ… |
| A0A521H411 | 316-743 | None |
| A0A0D2MVH2 | 304-724 | None |
| R5LJ60 | 489-863 | None |
| A0A497HSR1 | 165-491 | None |
| A0A662ZBF1 | 311-720 | None |
| A0A1V5URJ9 | 287-611 | None |
| A0A7X8A602 | 115-428 | None |
| A0A7V5ARD3 | 1-355 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.