DPCstruct | MC3442
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 87 ± 10 aa |
| Standard deviation of domain lengths | 10.36 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 84.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 51.16 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07011 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N6N4A8 | 8-85 | EVAKVGIEKSLVEVESILSENRVLISEINQNHESKIPDSISRNVGLIRELNNNIRKVVRLYSNLSSKFTWSEAHSKPN |
| V4MG54 | 3-78 | EDDEVWDTLSNGFKRAQLVLDQNRDLIQRVNENHRSRIPDNVTRNVGLINEINGNISRVMETYTDLSFEITKMFHE |
| C6ZKJ1 | 2-83 | None |
| A0A7J0E6X8 | 26-105 | None |
| I1IPW5 | 19-119 | None |
| A0A2C9VKY5 | 17-109 | None |
| A0A834T956 | 21-95 | None |
| A0A830CNA6 | 2-77 | None |
| A0A6V7P3R9 | 19-118 | None |
| A0A5N5JM37 | 44-135 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.