DPCstruct | MC34415
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 62 ± 4 aa |
| Standard deviation of domain lengths | 3.56 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 85.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 45.58 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y0S7D3 | 1-64 | TTEPGTCDTTGLVTYPALPQTDWAGNPSHANQGDKIIHNGVVYQANWWTAAEPGTDGSWSTVCN |
| A0A2A5HT63 | 136-191 | VDCSGTNTYPSWTAKDWPGGQANHSASGDAMVHNDRRYLANWHTSSEPGSDVSWEL |
| A0A509E146 | 444-500 | None |
| A0A1Q2M2V8 | 874-936 | None |
| A0A2A5HYU4 | 270-335 | None |
| A0A2A5HFW5 | 374-439 | None |
| A0A2A5HR66 | 635-694 | None |
| A0A1H5SCH6 | 747-810 | None |
| G0AWW1 | 1062-1126 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.