DPCstruct | MC34412
Metacluster Properties and Pfam Annotations
| Number of structural domains | 155 |
|---|---|
| Mean domain length (aa) | 234 ± 48 aa |
| Standard deviation of domain lengths | 48.07 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 84.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 21.55 |
| Pfam Score | 96.17 |
| Assigned Pfam label(s) | CL0031- CL0126- PF04674 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5J4JWA9 | 1-222 | MTAYAIFWEPTGSQVSASYHQLIEHYFQDVGTSALYHNNVQYSDSSGQAPTGASFGGSWIDRRPYPDSTLSDAQIQDEVRRALQMQG… |
| A0A534IZ95 | 69-291 | PPPRATVTGSLFNGSLIFAQISFRTRSGTVSLAVSDLQTAITYATLVVLPISRYAAQYGPNQSVVSTSPILFGADVPAGRYNDQILR… |
| A0A7V8NN30 | 1-181 | None |
| A0A538IVN0 | 22-267 | None |
| A0A6A2XT35 | 4-179 | None |
| A0A7Y7BA33 | 49-344 | None |
| A0A835APR0 | 360-662 | None |
| A0A7W1YB23 | 1-213 | None |
| A0A7C9E208 | 2-155 | None |
| A0A3D5DLY0 | 52-311 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.