DPCstruct | MC34410
Metacluster Properties and Pfam Annotations
| Number of structural domains | 59 |
|---|---|
| Mean domain length (aa) | 178 ± 23 aa |
| Standard deviation of domain lengths | 23.48 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 76.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 22.16 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0229 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G0S568 | 6-148 | CFVPDPKFTFYFQPSYNIICAICHDTQLYLSSESLPLKDSDPSVLPCGHVFGHECLTSWLRSHNTCPVCRFELKFELCPHRILPRRL… |
| A0A086T8H0 | 11-183 | HSRNTTSLSPSTGGEPVTDVFWPQLRGKLRSTPDAFGRLELECSICRKLMVLDTVAARGKGEADNTHVCIGVDILICGHIFGHSCIE… |
| G0RSV8 | 90-293 | None |
| A0A395T3H8 | 7-149 | None |
| A0A395T3I8 | 7-179 | None |
| A0A395SZ31 | 1-144 | None |
| A0A3L6NC76 | 1-135 | None |
| A0A4Q4WD86 | 1-201 | None |
| E3QPP8 | 126-313 | None |
| A0A4Q4Z0Q9 | 189-384 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.