DPCstruct | MC34407
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 91 ± 19 aa |
| Standard deviation of domain lengths | 19.49 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 76.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 43.09 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10203 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A835RV60 | 2-62 | ELVKCLSETDCVKVQNRPYRECAGEKEPSISSECIGLRETYFNCKRGQVDMRARIRGNKGY |
| A0A086SY63 | 1-95 | MPSSCKELREALAQCLQESDCVMVHRNSAADCLREPLVQTLPLQCQQLKKGFGECKRGLVDMRKRFRGNMPVTYRTLETSEGGKGYQ… |
| A0A3S0ZNR9 | 69-149 | None |
| A0A834Y5C7 | 1-82 | None |
| A0A1V6SEM1 | 115-217 | None |
| A0A0F4YKD9 | 1-108 | None |
| A0A4Q4VTI9 | 34-179 | None |
| A0A4U5N6K4 | 84-177 | None |
| A0A2K6WH52 | 18-93 | None |
| A0A5N5LMA1 | 449-509 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.