DPCstruct | MC34404
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 176 ± 27 aa |
| Standard deviation of domain lengths | 26.55 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 89.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 21.92 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0236 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A160N461 | 19-188 | GELCVLRALLHHLPCHIVADAWVGPLDGLQDFAFPPGAIEVKTTAAGGPFIARIGSLEQLDTSVIRPLYVAAVRLVQTSAGLTLPDA… |
| A0A0M4K1S2 | 114-298 | LFERQKRILKEEKLFGFFGELILLDKFCSIYPNAEMWWHRKDYMEFDFYINEKKEYLEVKANSIFKDNYLIKLDQISDTNPYLAGVS… |
| A0A2E0RS30 | 120-324 | None |
| A0A7J4T777 | 137-316 | None |
| A0A399XA10 | 29-194 | None |
| A0A291SUA8 | 2-186 | None |
| A0A5P6AB33 | 10-135 | None |
| A0A1S2N108 | 3-169 | None |
| Q6TP16 | 11-165 | None |
| A0A0E3UK73 | 3-156 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.