DPCstruct | MC34401
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 90 ± 11 aa |
| Standard deviation of domain lengths | 11.31 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 88.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 41.08 |
| Pfam Score | 83.33 |
| Assigned Pfam label(s) | CL0139- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| J2R532 | 1-78 | MDEAAIRQSVLEIVEQVQAYVPGYRLKQEPLFEENRVTVFLEVEGAGDYFPPYAGNLDIMTAAAVRVGEEVARHLLDG |
| A0A2X3K361 | 2-107 | MRDTVYVLSDEASQDDIEASINEMAEAVQAYVPGYRLKQRVQFEVIPQDKPVNLPGVGQFSGLKTAVWLEVEGAAHYLPAYAGNLDI… |
| A0A540P5H5 | 13-100 | None |
| A0A660T9T9 | 1-70 | None |
| A0A161Z4U5 | 1-103 | None |
| A0A2D0JJW4 | 5-82 | None |
| G9QIX4 | 1-87 | None |
| A0A6J4TL73 | 43-127 | None |
| A0A3S4P7S5 | 205-299 | None |
| A0A0N1NJ05 | 1-79 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.