DPCstruct | MC3440
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 69 ± 1 aa |
| Standard deviation of domain lengths | 1.28 |
| Length coefficient of variation | 0.02 |
| Mean AlphaFold2 pLDDT confidence score | 78.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 74.15 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5P1F9P5 | 1-67 | MPDVQALVNDFVLKLKRRKIEGSHASARQTAELLRSVVSHQPYTNQAAALISAVKAIGQQLIAANPV |
| A0A5N6MKW8 | 1-70 | MPDTHALVNDFLNKLRKRKIEGSKTTAKLTAELLRTVISQQRLPNTNQAGALIHAIKAIGEQLTAANPVG |
| A0A452Y9K0 | 1-69 | None |
| A0A2P6S9E4 | 1-70 | None |
| A0A5N5KME4 | 1-69 | None |
| A0A438GDJ3 | 1-72 | None |
| A0A1D6KW20 | 1-68 | None |
| A0A5P1EHH8 | 1-70 | None |
| A0A444FFW1 | 1-70 | None |
| V4S582 | 1-69 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.