DPCstruct | MC344
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 87 ± 6 aa |
| Standard deviation of domain lengths | 5.85 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 86.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 35.15 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2X3BY86 | 1-91 | MDTIKYQLNARRQPYGQGADLSLLNESVGNEVLAFHQKFPDYRVTPLRKLEFLSQRLGLGSIHIKDEAQRFGLNAFKGLGGSYAMGK… |
| A0A2X4ZH35 | 3-94 | AFSLKMDIAENRFFNGETSPLFSRQQAQQARRFHQKITGYKPTPLVALNELSALFGVQKILVKDESRRFGLNAFKMLGGSYAIARLL… |
| A0A1B8CQA4 | 1-90 | None |
| A0A1X1Q560 | 1-74 | None |
| A0A7Z9D5E5 | 1-92 | None |
| A0A7T7CAI8 | 1-85 | None |
| A0A6H0XVT3 | 18-99 | None |
| A0A3B0J9Z1 | 1-88 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.