DPCstruct | MC34399
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 121 ± 16 aa |
| Standard deviation of domain lengths | 16.16 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 68.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 52.67 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S3Y9N0 | 16-121 | AQDATEAELFSCPICYEPLMRKGPPGFNLPAIYRSGFKCRKCNKSYSSKNIYLDLTITSGTKEYSESKPARTELFRSPVVSFLYERG… |
| A0A453PCU1 | 11-105 | LACPICYYPLVSSIDHQSAPSKSDSSLECSTCKKLYSKDDYWDLTVAVGSTEYSETMPAATELFRTQLVSFLYERGWRQNFIWGGFP… |
| A0A4S8I8V6 | 12-115 | None |
| A0A2U1PWU1 | 46-171 | None |
| A0A7J7DTX0 | 39-168 | None |
| B4FWV6 | 41-179 | None |
| A0A7J9N1E4 | 35-167 | None |
| A0A5N5J6T5 | 23-121 | None |
| A0A453T4B2 | 82-211 | None |
| A0A2G5E9I4 | 1-146 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.