DPCstruct | MC34398
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 113 ± 19 aa |
| Standard deviation of domain lengths | 18.50 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 68.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 51.65 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B6SL21 | 1-91 | MFDIVMPDFAGVYSFLGSVFDPSTSGHLQKLKEMNPIDVETALLLMRNLSINLTSPDFEDQRKLLSLYSASDGPGLGSSRSSALATS… |
| A0A1S3Y8Y8 | 17-122 | NSSISGIRSFSRTAPSSEQPEQSKLGSVPHGIPDFAEVYSFIGSVFDPDTKGHVQKLKEMDPINFETVLLLMRNLTMNLSSPDFEPI… |
| A0A0A9P8F2 | 21-162 | None |
| A0A446N9Y4 | 19-150 | None |
| A0A0K9QSK7 | 102-214 | None |
| A0A5B6YKQ0 | 43-203 | None |
| A0A7N0U5V0 | 56-179 | None |
| A9TBE7 | 108-227 | None |
| A0A445IIA3 | 250-341 | None |
| A0A5J5U9P1 | 96-200 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.