DPCstruct | MC34397
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 161 ± 17 aa |
| Standard deviation of domain lengths | 16.61 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 83.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 36.65 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0021 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S3Y8Y5 | 3-154 | GTLDHNMLLQSTKAYKNAAKDQKMTRSAELWYNCSMAYKFLENYLMALTGLIMDPNLKSLEQTLNLCDVLDYINSLLQKLNDAKQLS… |
| A0A0L8FQK4 | 56-223 | LGNAYLSLFFAEGQNPKTLKQAMSAYNQAVRDPVAKNNPDLHFNRAIAYKYQEDYQEALEGFSTAKALDCDWLGPVEQETRLLDFLT… |
| A0A1S3YV52 | 2-172 | None |
| A0A287KWU1 | 2-126 | None |
| A0A287KWT2 | 35-194 | None |
| A0A833VGY2 | 72-246 | None |
| D7G7M4 | 137-304 | None |
| A0A4V4H9C7 | 353-514 | None |
| A0A1J6IFR0 | 304-467 | None |
| A0A1J6K473 | 117-243 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.