DPCstruct | MC34394
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 116 ± 16 aa |
| Standard deviation of domain lengths | 16.43 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 83.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 38.03 |
| Pfam Score | 93.81 |
| Assigned Pfam label(s) | CL0182- PF03105 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S3Y619 | 4-96 | AFVEFYQKLRLLKNFCLLNVLAFSKIMKKYDKITSRKASKSYLEMVNKSYLGSSDEVAKLIERVEATFIKHFVNGNRRKGMKSLRPQ… |
| A0A819VNU1 | 3-97 | AFSELYLLLVLLQNYQTLNYMGFKKILTKHDKLFHKINGIEWFKTNIDSSPFVSNQQVSNLIDEVEILVTDHLENVNRKKAMQKLRV… |
| A0A1R3JKN6 | 197-295 | None |
| A0A4S2MR19 | 221-347 | None |
| A0A445J029 | 87-187 | None |
| L0P8S7 | 18-127 | None |
| A0A565BRE9 | 171-269 | None |
| A0A0L7L6F9 | 31-162 | None |
| A0A1X7T578 | 33-145 | None |
| I1C2E5 | 150-257 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.