DPCstruct | MC34391
Metacluster Properties and Pfam Annotations
| Number of structural domains | 54 |
|---|---|
| Mean domain length (aa) | 95 ± 14 aa |
| Standard deviation of domain lengths | 13.52 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 71.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 48.46 |
| Pfam Score | 97.14 |
| Assigned Pfam label(s) | CL0023- CL0137- PF04571 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q5ZIR2 | 6-101 | QLAGQVLVTVKELYKGINQATLSGCIDVVVVRQQDGTYQCSPFHVRFGKLGVLRSKEKVIDIQINGDAVDLHMKLGDNGEAFFVQET… |
| A0A6G0I6Z1 | 59-154 | QLAGQVFVQVKELYRGLNPATLSGCIDVIVVRQPDGSLQCSPFHVRFGKMGVLRSREKVVDMEINGEPVDLHMKLGDNGEAFFVQET… |
| A0A673BMJ1 | 1-77 | None |
| A0A673BK23 | 23-116 | None |
| A0A2G8L4T0 | 2-83 | None |
| F4Q1P4 | 53-135 | None |
| A0A5M3MAP2 | 1-113 | None |
| A0A4S4CYR6 | 1-109 | None |
| A0A0V0QB29 | 4-104 | None |
| A0A6I9PQ03 | 63-142 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.