DPCstruct | MC34390
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 240 ± 30 aa |
| Standard deviation of domain lengths | 30.16 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 69.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 40.02 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05542 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5D2R4C6 | 1-208 | MVPDKYRGGRCLTMRALGESGDNLSPIAPVEFESPVGQLLAQILRTHPHLLPAAVDQQLDNLQSDKNDQTEETLQSHDLLYKRIAEV… |
| A0A1S3Y1C8 | 1-254 | MDCGLSYSKISLHQSLLFTVKTTLLSSSTRFTFKNSPFTSSSVGSRRSLFVVASGNSSSKCEFSGLNAPLVPTTPTGRLLSTVLLND… |
| A0A6A4NTE2 | 1-196 | None |
| A0A6D2K8G2 | 30-273 | None |
| A0A6D2K3Y5 | 29-234 | None |
| A0A5J5BK77 | 3-277 | None |
| A0A5N5HX38 | 1-290 | None |
| A0A0A0LQJ8 | 194-436 | None |
| A0A5B6ZND1 | 14-256 | None |
| A0A6N2KFV8 | 18-216 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.