DPCstruct | MC3439
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 237 ± 49 aa |
| Standard deviation of domain lengths | 48.87 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 65.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.53 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 42.03 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06217 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7G2FAZ9 | 18-257 | SILAERDAAVKERNEAVAATKEALASRDEALEQRDKALSERDNAIMETESALNALRYRENNLNYILSCAKRDGSQRFITEESHLPNP… |
| A0A5N6MKS1 | 31-260 | AVLQRDAALAERNSAMQERDEAITTLRFRGNFINQNIISTTSESPERTQNHGSKRGYNYEETHHMFEIPDDYQLSPENIKPRKVIKK… |
| O82286 | 37-226 | None |
| A0A4S4E5Z2 | 145-412 | None |
| A2Y8V8 | 43-274 | None |
| A0A5S9X4F8 | 92-271 | None |
| A0A2J6KCK3 | 4-189 | None |
| A0A314UEJ3 | 435-710 | None |
| A0A5P1FQI4 | 2-225 | None |
| A0A5C7HIZ4 | 266-455 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.