DPCstruct | MC34383
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 197 ± 27 aa |
| Standard deviation of domain lengths | 27.21 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 86.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 29.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X0P8C2 | 188-355 | GIGLHLMDGRQVKIVNCLLDGNADAARNVLDASTLTMPWETQVAACLHVMCCITGDQPAKRVTSWMIHRYLAGRPEHGHAIFRARLG… |
| K4QSP4 | 11-195 | QRMLDGRQVAVLATLVANDTAGAAGLLADTLPGDPWEQAVTACLTVLCRRDAGQPIDGHLADLVTAYSRRKAEPGMTVFDTRLGLTV… |
| A0A652NX92 | 21-226 | None |
| A0A1C4W774 | 1-154 | None |
| A0A2G9DRZ0 | 155-317 | None |
| A0A1I1YV07 | 31-244 | None |
| A0A7W3MVV7 | 451-669 | None |
| E3J6B5 | 88-281 | None |
| A0A285QW15 | 73-302 | None |
| A0A841G0H5 | 139-324 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.