DPCstruct | MC34379
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 128 ± 6 aa |
| Standard deviation of domain lengths | 5.93 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 80.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 45.73 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A8B6C4Q1 | 48-170 | QIVRKDMMAMQYIFNGTFETGCQQNSVPQSLKTIVGMILGGPNIKMQSIEEQTTLTSSQLLQFNSSICRRKDSSPVFHSTEREPFLS… |
| A0A8B6DL88 | 5-127 | IRCQLASTKTTFSGSLVSEDIDDSIPPPLLRMVKMIKHGPDIESQLDNISSKSDLALTQPLMFNYHTNRQKMTVEQIHSADHETPFC… |
| A0A8B6BXK6 | 347-483 | None |
| A0A7J6D580 | 198-329 | None |
| A0A6S7GAC0 | 159-285 | None |
| A0A6J8CXI5 | 505-641 | None |
| A0A6J8F5B5 | 125-249 | None |
| A0A8B6DM82 | 629-752 | None |
| A0A6J8BZT7 | 270-389 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.