DPCstruct | MC34375
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 94 ± 10 aa |
| Standard deviation of domain lengths | 10.28 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 71.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 29.63 |
| Pfam Score | 92.86 |
| Assigned Pfam label(s) | CL0247- CL0084 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| V9LC56 | 22-102 | MRQDCELAIFIDLRRALSDGIPFFWSANKVILTPGNESGLLPPSLFQRVVQLKPNRRLLSLDGAEDRSAPREDNSRGQQCD |
| A0A8B6DCY0 | 1-82 | MRQSCEVMIFINLETALADGFKFFRSANNVILCAGNEDGVIPPKYFVKVLAMKRQPEEEIIQPSPQKKRRLGKENRKIQSVV |
| K1PPY4 | 2-92 | None |
| A0A812KPX1 | 71-164 | None |
| B6K5D9 | 146-242 | None |
| A0A2G8JWC1 | 109-190 | None |
| A0A060SBJ8 | 21-119 | None |
| A0A2R6P168 | 1-108 | None |
| A0A6P7SYI6 | 212-324 | None |
| A0A6J8B830 | 16-110 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.