DPCstruct | MC34374
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 110 ± 9 aa |
| Standard deviation of domain lengths | 8.63 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 76.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 51.06 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10491 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A402E7W2 | 1-105 | AQLRAFIPEMLKYSTGRGKPGWGKESCKPVWWPEDIPWANVRSDVRTEEQKQRVSWTQALRTIVKNCYKQHGREDLLYAFEDQQTQP… |
| A0A146MBN9 | 178-275 | PTPVEKMTQAQLRAFIPLMLKYSTGRGKPGWGRESTRPPWWPKELPWANVRMDARSEDEKQKISWTHALRQIVINCYKFHGREDLLP… |
| A0A7R9C0V0 | 151-262 | None |
| A0A0A9XAI2 | 1-113 | None |
| A0A8B6DFZ2 | 81-206 | None |
| A0A7T8K7Z2 | 1-107 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.