DPCstruct | MC34371
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 240 ± 23 aa |
| Standard deviation of domain lengths | 22.65 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 78.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 28.29 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| V3ZC28 | 57-287 | TTVNRSVGKCIRPDVCECKQVGFYSAGSFCDICSPINNCDLEYCTTKTDQKCRKCEGLVQDRPGYRAYILSADKRSCEKACSWRPDS… |
| A0A8B6D2Z5 | 1-231 | CPQIANCNHRRCSNPADNYCEWCQYEIVDKQYWRAYTRHKDGHMKECRKTCSWRFDSTRCYPGNCTDEVAQSCVCTDGFGGNHCDTI… |
| V4BIX7 | 4-249 | None |
| A0A6J8ENT6 | 85-324 | None |
| A0A8B6D404 | 1-289 | None |
| A0A8B6DGL9 | 1-233 | None |
| A0A8B6E943 | 131-381 | None |
| A0A6J8A0R8 | 126-370 | None |
| A0A6J8C4Q9 | 74-265 | None |
| K1R3L9 | 41-286 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.