DPCstruct | MC3437
Metacluster Properties and Pfam Annotations
| Number of structural domains | 70 |
|---|---|
| Mean domain length (aa) | 291 ± 72 aa |
| Standard deviation of domain lengths | 71.68 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 77.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 25.77 |
| Pfam Score | 94.70 |
| Assigned Pfam label(s) | CL0220- CL0208- CL0649 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P6Q934 | 1-172 | MEVDYGITQYLGDRSISVPCVMKELYSDFIVQEILEDETVLRLATASEVRSYVKEEEEKGVDEAVDVPSSLSAEQVTALDALDKNSK… |
| A0A5N6MJY0 | 5-312 | LEESDVGISCYISPLPGFRGILKQRYSDFVVNEVDLDGNIVHLTSLEAPTEIAKEPETKTIDQLNGNYGTEIESFRALAGDSDANCL… |
| A0A183E7R5 | 2-246 | None |
| A0A2V2VTU6 | 14-233 | None |
| A0A7J6PVU7 | 42-354 | None |
| A0A7J6PE54 | 47-486 | None |
| R7UEY7 | 70-247 | None |
| A0A3Q0KLJ9 | 18-292 | None |
| A0A3Q7ENG9 | 46-339 | None |
| A0A3P6TW53 | 4-230 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.