DPCstruct | MC34365
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 162 ± 19 aa |
| Standard deviation of domain lengths | 18.69 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 82.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 19.80 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M1FXA6 | 66-221 | TPAGAITHSIVSIKGQLEPDITVHHARTPIARIGITVGGMHMSLQNCQTAQGLLEAFVAARTQMIHVPAEIPTAGAAADEPAGRAVL… |
| A0A4Q7V617 | 24-168 | LSSVMSVGVRVAGRVPTRVDLRFAGTPEQQLGLSLGTVLVYLRTYLATRTISLGWGEAAAQARSLSPVLPERRRPVMMSGPWTVSAV… |
| A0A292Z3R9 | 1-154 | None |
| A0A544ZJI5 | 3-150 | None |
| A0A1E8Q8I9 | 3-152 | None |
| A0A263DI99 | 1-181 | None |
| A0A1E4I972 | 15-184 | None |
| A0A511DKW5 | 102-273 | None |
| A0A5Q2RKH1 | 1-213 | None |
| A0A2W6QUG7 | 32-188 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.