DPCstruct | MC34360
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 152 ± 17 aa |
| Standard deviation of domain lengths | 16.76 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 28.69 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3D1TPG9 | 6-147 | QLVSLDPRCSVRVYRTHSGLRYLLTHSPAEPNSEATWRAMEVLGADPLYVRLCKNQECFRARLTPKPWRCGSYALRTRYPYEDQKAE… |
| A0A651H999 | 140-288 | AELGMQRLTAWAAAHPDKSLRIYRTRAGLRLLFTDALYQARSPEVAGLLESLGSDPLYRRLTERQDCFRARLTPKPWRCGQRRPPAP… |
| A0A3D2IVM0 | 221-397 | None |
| X0QUL4 | 31-209 | None |
| A0A1H3JQS0 | 178-332 | None |
| A0A7X7FB37 | 16-168 | None |
| A0A6S6S8A4 | 247-388 | None |
| A0A3D9UKD9 | 83-251 | None |
| A0A2W4Y8T7 | 12-160 | None |
| A0A846FNA5 | 86-215 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.