DPCstruct | MC34359
Metacluster Properties and Pfam Annotations
| Number of structural domains | 62 |
|---|---|
| Mean domain length (aa) | 89 ± 13 aa |
| Standard deviation of domain lengths | 13.20 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 85.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 39.08 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02601 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A410P756 | 156-247 | ERRFPRARVVINPVRVQGEGSAEEIARAVEEFNAWGQPDVIILARGGGSLEDLWSFNEERVARAIAASGIPVVSAVGHETDYTIADF… |
| A0A7U0MX18 | 46-118 | LEQLKEKLRLNTKNAFDAIVVARGGGSMEDLYSFNDEKIADALHLAKTFSMSAIGHESDFLLSDLVADLRAST |
| A0A7C3DS66 | 186-267 | None |
| A0A7T9A0A8 | 17-101 | None |
| A0A7C2Q3Y3 | 61-144 | None |
| A0A260BHT1 | 272-351 | None |
| A0A543IKQ6 | 199-304 | None |
| A0A3D2GHS4 | 13-107 | None |
| A0A2T2SZW6 | 14-98 | None |
| A0A809NGV3 | 123-201 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.