DPCstruct | MC34355
Metacluster Properties and Pfam Annotations
| Number of structural domains | 561 |
|---|---|
| Mean domain length (aa) | 126 ± 24 aa |
| Standard deviation of domain lengths | 24.14 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 78.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 15.63 |
| Pfam Score | 85.91 |
| Assigned Pfam label(s) | PF15350- CL0129- CL0153- CL0219- PF03522 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A537G5P0 | 17-132 | LEISPEPERINPAGIDLRAIKKLTIKPRHQTLAATMERIGLPNNFLGILHLRSSFAREGVIASLALVDPGYQGQLTISLYNAGARPV… |
| A0A497RTR0 | 6-119 | DEVIRQGYLAISPYTTVEQVGIDLSIERNVDLKGNHEVVRLNEQFNLPSDIFAILFPRSTLIRKGFIIQCGVIEPGYIGRPVVAIHG… |
| A0A7R9NYQ4 | 179-291 | None |
| A0A535W327 | 1-135 | None |
| A0A2H0T9F4 | 15-169 | None |
| A0A2H9T5P4 | 412-525 | None |
| A0A1R0GXH6 | 128-288 | None |
| A0A101MGU4 | 7-114 | None |
| A0A1A9X6B7 | 3-152 | None |
| A0A6V7SYT3 | 2-132 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.