DPCstruct | MC3435
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 228 ± 35 aa |
| Standard deviation of domain lengths | 34.53 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 76.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 19.32 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14953 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C3PF27 | 16-284 | VCTSVQGVLEMFSALRHVHKSKLQQFSFDITVIAFALRCGYLFDAFGLRRHQTELQDFLAEVLTKLRDMLPVFESVTLLYDPASVQI… |
| A0A5N6M8I1 | 4-264 | SEALRVLNSSLSRINWRLKPSSKRRFETDILALCMGLRPVIMIDYGGKMPELRDRLCAFVKFSQGESSIFENIRIMVIEDMIYLIDV… |
| A0A162U304 | 1-181 | None |
| A0A4W3GPE6 | 5-207 | None |
| A0A2C9KE39 | 23-236 | None |
| A0A4S4DC63 | 31-222 | None |
| A0A0F7S5W0 | 28-255 | None |
| F4Q3A9 | 35-294 | None |
| A0A7N0TU91 | 1-253 | None |
| A0A5C3MI18 | 7-235 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.