DPCstruct | MC34345
Metacluster Properties and Pfam Annotations
| Number of structural domains | 50 |
|---|---|
| Mean domain length (aa) | 81 ± 5 aa |
| Standard deviation of domain lengths | 5.01 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 81.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 31.59 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A139RGZ9 | 1-71 | MNLVVVEFQEGGNGYTYICDDPTIQIGHGVIVPTGKENIEKIALVVQKYHAYPRDITYPVEKLKRVIRRYS |
| A0A0R1U1K8 | 126-199 | SDQKYKFCAVSFNESFQTYSYLCEDETIQVGDQVIVPVGPQNVELEATVKKIIYATKAAAPYPFNKLKKIIKRV |
| A0A0R1YU58 | 425-505 | None |
| S0KJZ6 | 278-355 | None |
| A0A410Q4Y5 | 307-389 | None |
| R6UB06 | 183-255 | None |
| A0A2P8EGT4 | 64-146 | None |
| A0A0R1ZXL3 | 350-425 | None |
| A0A6B1NK14 | 2-82 | None |
| A0A355V0B1 | 2-82 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.