DPCstruct | MC3434
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 283 ± 39 aa |
| Standard deviation of domain lengths | 38.74 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 77.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 36.90 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B0G167 | 3-344 | WKELTPIGFEFNTWESMKKEGWTFPELKREFKRGVLSHAQTDKPLYMFLGAQPIVEGDYAFNMPYIVVFDCPSPPPSKICKASIQGG… |
| A0A5N6M3N8 | 21-251 | LWKQAPVFPVGARDAFTEGGVLHGEEKVFLFTCAERQVILFDGQLKQVFMPVVVVIVSPFPPSDKIIVQKGNGCEEVIDMEKINMAW… |
| A0A7S2MWD0 | 15-300 | None |
| A0A2P6N2Q2 | 165-374 | None |
| A0A5N6PQT2 | 43-348 | None |
| E1F5Q2 | 1-318 | None |
| A0A6V7PBE6 | 319-637 | None |
| A0A2U1M6J5 | 2-299 | None |
| F1A050 | 17-358 | None |
| A0A2U1N7U7 | 4-261 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.