DPCstruct | MC34339
Metacluster Properties and Pfam Annotations
| Number of structural domains | 114 |
|---|---|
| Mean domain length (aa) | 160 ± 31 aa |
| Standard deviation of domain lengths | 31.09 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 74.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 18.24 |
| Pfam Score | 97.55 |
| Assigned Pfam label(s) | PF19338- CL0079 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A443SNG1 | 371-476 | YKDGGYICPSSVAYIYPRRAMNVAGLWKVILNLRERYKGKEYKQSVRVERCLYPRMECSFTSKFYNSQCIQKYNNHRLVAWTIEKGI… |
| A0A1J1IMQ3 | 37-172 | FPKYPTKILNTFNLLWPNLSKEKRSMELQHNSIFTERKLCESQSAFIRPQKLKNVNEEMKLIVNHQNFTQIVRFETCSSENFPCTYN… |
| A0A7M7HHD4 | 5-130 | None |
| E9FUQ9 | 25-158 | None |
| E9G384 | 123-262 | None |
| A0A1D2NN87 | 401-540 | None |
| A0A182F4G4 | 420-589 | None |
| A0A6A4KNK7 | 185-409 | None |
| V4CDU1 | 340-502 | None |
| A0A226EZV9 | 14-177 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.