DPCstruct | MC34338
Metacluster Properties and Pfam Annotations
| Number of structural domains | 95 |
|---|---|
| Mean domain length (aa) | 184 ± 44 aa |
| Standard deviation of domain lengths | 43.92 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 74.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 18.82 |
| Pfam Score | 98.08 |
| Assigned Pfam label(s) | CL0512- PF02330- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1J1IMB5 | 518-715 | HFINILHQSEKELVEFLAEEIVAERKAQKKKTLPSEIDGFKVKLDGADVDFVKDLGNEKVSVSFNVNHTVDTEEEPDINMEQDKPEL… |
| A0A0G4EIV9 | 17-209 | DSASSKLSEVVANEISHEKSQYEKPPIIQRFLDKKEWKFEEKTADVNMVLTKEVDGTKVSVEFQLSTPYNPEDEGGEGEGGEESTPT… |
| A0A6J1A747 | 4-149 | None |
| A0A1R3K257 | 62-215 | None |
| A0A6P5GT43 | 44-259 | None |
| A0A0C2JQT6 | 30-258 | None |
| A0A4Y7IZU3 | 71-257 | None |
| A0A453DWV9 | 35-158 | None |
| A0A3P7LQY3 | 40-192 | None |
| A0A1V8SQT9 | 3-313 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.