DPCstruct | MC34333
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 59 ± 6 aa |
| Standard deviation of domain lengths | 5.92 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 73.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 37.63 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C8PBZ5 | 171-226 | ASPPPAPASGTIVGSVPADCRQVGVASTTYLLCGAIWYAPRFSGNQVVYVVVDAPT |
| K5CZ83 | 4-58 | ATATAVAVGTIIATLPPDCTTVVVNGVSYRDCGGNWFEPRYDGHTVIYVAVSDPR |
| A0A1W1E778 | 72-139 | None |
| A0A2T7HCC7 | 117-171 | None |
| A0A3N5P2F7 | 84-153 | None |
| A0A8B6M1A5 | 135-189 | None |
| A0A1M4UX66 | 83-137 | None |
| A0A2V3UIF7 | 142-197 | None |
| A0A7H0G6K3 | 178-234 | None |
| A0A0T2QGQ2 | 221-287 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.