DPCstruct | MC3433
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 70 ± 4 aa |
| Standard deviation of domain lengths | 4.38 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 83.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 68.33 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1H0X1Q5 | 1-77 | MPYSTNAIESLNARLRRSVKARGHFPTEQAALQCLYLAIRSLDPTGNGRRAWMIRRKSALNAFAITVEGRIIPTMDQ |
| A0A7Z0A1V9 | 1-67 | MNARYRRAVRARGHFPTEQAAMKTLYLVTRSLDPKGTGQTRWAMRWKPALNAFAITFADRMPAAEDR |
| A0A510CW26 | 123-190 | None |
| A0A2N0J7R2 | 218-284 | None |
| X8FP75 | 1-76 | None |
| A0A6G5RNL7 | 60-127 | None |
| W5WAW4 | 187-254 | None |
| D5ZU86 | 140-207 | None |
| A0A7I7LU45 | 2-64 | None |
| A0A5A4W771 | 30-104 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.