DPCstruct | MC34328
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 143 ± 14 aa |
| Standard deviation of domain lengths | 14.43 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 89.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 33.30 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X8E1U8 | 78-221 | LLAVIDENLDQSWAVPLASHLGAFETGEERELRQGRRYAVARRLAGLFASYARQRPELLVSWLDGDPAEPDLAWQPPLWRALVARVD… |
| A0A378A9L2 | 95-242 | LMTLLPQHLEEDDFILLRQYLSDDGDKRKLFQLAARVADLYDQYLVYRPEWLMRWEAGQRVEGLGDAQQWQAPLWQALVSYTAELGQ… |
| A0A1P8YP22 | 100-244 | None |
| A0A7V2YWJ4 | 3-121 | None |
| J5KQC7 | 73-243 | None |
| A0A1W9PWC5 | 122-261 | None |
| A0A5C2HHW2 | 107-265 | None |
| A0A7K0JQJ4 | 162-306 | None |
| A0A509MKJ3 | 1-138 | None |
| X7ZLQ1 | 4-126 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.