DPCstruct | MC34325
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 171 ± 17 aa |
| Standard deviation of domain lengths | 16.63 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 30.31 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A821B0Z7 | 56-212 | KNTSSNDLFDALNAAIADVQREDTDETLLTQNNRTNLIRAYTCRQNTQLPVPNRNDTRGILRDILFNTTKIVIGGLGPKNWGVHDGN… |
| A0A815HT18 | 44-209 | APEVSGKEFRNAINLAIMKVQAQGIEFDLAAKYQENIVDVRTCKIDNTDEFPIPNRAEATGLLKTVLEKGIIPIGTFGDLNSTDSDD… |
| A0A822B2P1 | 56-211 | None |
| A0A7S1KK66 | 248-460 | None |
| A0A7S0DKQ0 | 136-329 | None |
| A0A817DMZ3 | 423-586 | None |
| A0A814IH43 | 17-172 | None |
| A0A814EIP1 | 124-281 | None |
| A0A819VV01 | 117-284 | None |
| A0A815CLT2 | 266-433 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.