DPCstruct | MC34323
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 91 ± 19 aa |
| Standard deviation of domain lengths | 18.52 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 85.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 37.91 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N9CUT4 | 12-91 | GKNASSMEQVADKIVRYLYNHIVEEDTGARCLSLVRLFKTHPYEDVDPELKRFAVDALGHEPEVASTKCLTLSATAGVKD |
| A0A5N9CV38 | 1-75 | MKDEANKIGSYLYENISDSSGGNANALVRFYKTHPYNRLDQGLQGFAQGILGSAPSDETNCLPMLATNGDNDDWK |
| A0A1E3X913 | 1-136 | None |
| A0A2C9C9K9 | 26-117 | None |
| A0A7V9UCR5 | 1-77 | None |
| A0A7V9BTT7 | 98-193 | None |
| A0A1Z4TI84 | 26-116 | None |
| A0A5N9ECD8 | 2-81 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.