DPCstruct | MC3432
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 130 ± 24 aa |
| Standard deviation of domain lengths | 23.67 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 89.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 27.92 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1H0WTL5 | 9-159 | ETARRLQERVARALPAEHVERLGGWWLRHAPGASWWTSTVLPHGVLGDDRLMRAVSAAEGFYAGFGRAATFQITPGACPVELDALLA… |
| A0A550HBA1 | 3-158 | ITLLTPKEIRLIEHAACRAWPAKHTKEYGGWLFRATDGITRRANSVLPLGSPEGQNLEASLEATRKFYRQHRLPVRFQMTVASQPPE… |
| A0A3G5TBF7 | 28-123 | None |
| A0A3C0P8X5 | 6-153 | None |
| A0A1W6WCJ0 | 1-151 | None |
| A0A2W6C1J7 | 67-163 | None |
| A0A1E3L7Q3 | 1-115 | None |
| A0A2E8GX91 | 4-147 | None |
| A0A069DH41 | 4-94 | None |
| A0A511TNI8 | 10-135 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.