DPCstruct | MC34317
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 137 ± 32 aa |
| Standard deviation of domain lengths | 31.53 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 82.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 43.79 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1B9M0F5 | 139-239 | EPLVCYVQPNLNNGSGRHAGPKEQWDPDNGFKVQSLSDASKNFPTTVANNLYFKLMLAGMTAKKMIAINGNTVKPVSGTGITLLLTA… |
| A0A844X1I0 | 13-135 | TYKNGRGDNRSDAIILPSEPPVAISFARPNKDWGTDEYAGPADIWNPNGGFLITQSDPTSYALNFPTTGADGLYFDLEIEGVDPDQL… |
| A0A1B9KI02 | 1-163 | None |
| A0A1C4BRV7 | 1-182 | None |
| A0A1B9LTM3 | 1-130 | None |
| A0A1B9MFX3 | 10-148 | None |
| A0A1B9M207 | 5-123 | None |
| A0A1B9M9B7 | 1-166 | None |
| A0A2V4E6E0 | 71-166 | None |
| A0A1B9LX60 | 1-154 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.