DPCstruct | MC3431
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 262 ± 50 aa |
| Standard deviation of domain lengths | 49.88 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 89.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 20.78 |
| Pfam Score | 95.83 |
| Assigned Pfam label(s) | CL0023- CL0237 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1H0NWE0 | 1-294 | MPDHVPPVADSRFWGEERGLAGACYPVACRGLDAAAMLRRLWREFVSPDLRARFAELLELSEEESRRLLEFWAAAHDIGKITPSFQA… |
| A0A399F3Z4 | 2-219 | GHLLDVAACTEVILEREPPKTLELYARDLGLEPAQTKAWVCALAGLHDLGKASPAFQQKWPEGKKRVWEAGLTWAVDPTPPPNDISH… |
| A0A5N0V1G0 | 27-273 | None |
| A0A1F4DQR8 | 4-238 | None |
| A0A640TU15 | 1-393 | None |
| A0A850T2B2 | 16-218 | None |
| A0A355UYR3 | 1-204 | None |
| A0A2D5V6U5 | 1-212 | None |
| A0A095YX97 | 1-287 | None |
| A0A7V9NL30 | 2-249 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.