DPCstruct | MC34303
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 220 ± 26 aa |
| Standard deviation of domain lengths | 26.39 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 82.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 23.45 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X7ND28 | 20-245 | LADRGYIREEVAAFVKKYFKPGKYKDILADKTPVYLVMPSTRGDNTIPLGIAELLEMTYGGEVIKGFAGAMHETRSANLGAIGKLKE… |
| A0A0Q9YT70 | 200-460 | MDPKDIEKLLDQSIKNYKPEFGNEIAIVRPIKDYDKAGTNYNILTNMYSQMLVRELNKLKETKYPELSGVSFVDEPVMTLTATSRTD… |
| A0A2Z6IKY8 | 45-252 | None |
| A0A0W0VKY1 | 85-372 | None |
| A0A0F2NN79 | 55-272 | None |
| A0A109BYV1 | 9-202 | None |
| A0A1K1NVZ2 | 422-620 | None |
| D2ZSZ8 | 80-299 | None |
| A0A7X4CMC9 | 39-248 | None |
| A0A445MXZ5 | 8-209 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.